Наследование групп крови резус

Наследование групп крови резус

На рисунке представлено положение резус белка резус в мембране эритроцитов.

Положение белка резус в мембране эритроцитов

Почему он так назван? В 30-40-х годах, когда довольно интенсивно проводились исследования групп крови, было обнаружено, что антитела к группе крови мартышки резус агглютинируют у некоторых людей их эритроциты.

Агглютинация – это процесс склеивания эритроцитов под действием антител к белам, расположенным на мембранах эритроцитов. На рисунке ниже представлен картина агглютинации. Здесь изображены капельки крови , к которым добавлена сыворотка, содержащая антитела к резус-белку. Синим обведены капли, в которых с кровью ничего не происходит. Если реакция при добавлении антител не идет, то, значит у данного человека резус-белок отсутствует. Красным обведены образцы крови, в которых происходит агглютинация. Буквами помечены капли крови, которые реакцию дают, но очень слабую. Такое встречается у приблизительно 1% людей, и это так и называемый слабый резус фенотип.

Метод определения резус-группы крови

С чем это связано? На рисунке ниже буквами представлена последовательность резус-белка. Вы знаете, что белок состоит из 20 аминокислот, каждая из которых обозначается своей буквой. Ген (последовательность нуклеотидов, соответственно, в 3 раза более длинная последовательность, записанная только четыремя буквами, а не 20), который кодирует резус-белок, называется RHD.

АМИНОКИСЛОТНАЯ ПОСЛЕДОВАТЕЛЬНОСТЬ РЕЗУС-БЕЛКА ЧЕЛОВЕКА

(каждая аминокислота обозначена одной буквой):

Информация из базы данных NCBI

Human RhD blood group antigen mRNA, complete cds

ORGANISM Homo sapiens

standard_name="RhD"

MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQV

GQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQ

FP SGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTA

LGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKD

QTATIPSLSAMLGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSV

VTAISGSSLAHPQGKISKTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGL

VAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVL

DTVGAGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHEA

KYFDDQVFWKFPHLAVGF

ПОСЛЕДОВАТЕЛЬНОСТЬ НУКЛЕОТИДОВ КОДИРУЮЩЕЙ ЧАСТИ ГЕНА РЕЗУС-БЕЛКА ЧЕЛОВЕКА

Информация из базы данных NCBI

1

atgagctcta

agtacccgcg

gtctgtccgg

cgctgcctgc

ccctctgggc

cctaacactg

61

gaagcagctc

tcattctcct

cttctatttt

tttacccact

atgacgcttc

cttagaggat

121

caaaaggggc

tcgtggcatc

ctatcaagtt

ggccaagatc

tgaccgtgat

ggcggccatt

181

ggcttgggct

tcctcacctc

gagtttccgg

agacacagct

ggagcagtgt

ggccttcaac

241

ctcttcatgc

tggcgcttgg

tgtgcagtgg

gcaatcctgc

tggacggctt

cctgagccag

301

ttcccttctg

ggaaggtggt

catcacactg

ttcagtattc

ggctggccac

catgagtgct

361

ttgtcggtgc

tgatctcagt

ggatgctgtc

ttggggaagg

tcaacttggc

gcagttggtg

421

gtgatggtgc

tggtggaggt

gacagcttta

ggcaacctga

ggatggtcat

cagtaatatc

481

ttcaacacag

actaccacat

gaacatgatg

cacatctacg

tgttcgcagc

ctattttggg

541

ctgtctgtgg

cctggtgcct

gccaaagcct

ctacccgagg

gaacggagga

taaagatcag

601

acagcaacga

tacccagttt

gtctgccatg

ctgggcgccc

tcttcttgtg

gatgttctgg

661

ccaagtttca

actctgctct

gctgagaagt

ccaatcgaaa

ggaagaatgc

cgtgttcaac

721

acctactatg

ctgtagcagt

cagcgtggtg

acagccatct

cagggtcatc

cttggctcac

781

ccccaaggga

agatcagcaa

gacttatgtg

cacagtgcgg

tgttggcagg

aggcgtggct

841

gtgggtacct

cgtgtcacct

gatcccttct

ccgtggcttg

ccatggtgct

gggtcttgtg

901

gctgggctga

tctccgtcgg

gggagccaag

tacctgccgg

ggtgttgtaa

ccgagtgctg

961

gggattcccc

acagctccat

catgggctac

aacttcagct

tgctgggtct

gcttggagag

1021

atcatctaca

ttgtgttgct

ggtgcttgat

accgtcggag

ccggcaatgg

catgattggc

1081

ttccaggtcc

tcctcagcat

tggggaactc

agcttggcca

tcgtgatagc

tctcacgtct

1141

ggtctcctga

caggtttgct

cctaaatctt

aaaatatgga

aagcacctca

tgaggctaaa

1201

tattttgatg

accaagtttt

ctggaagttt

cctcatttgg

ctgttggatt

ttaagcaaaa

1261

gcatccaaga

aaaacaaggc

ctgttcaaaa

acaagacaac

ttcctctcac

tgttgcctgc

1321

atttgtacgt

gagaaacgct

catgacagca

aagt//

   
Перейти на страницу:
1 2

Водные клопы гладыш, гребляк, плавт, водяной скорпион
Водные клопы: гладыш, гребляк, плавт, водяной скорпион Гладыш Гладыш (Notonecta glauca L.) относится к отряду клопов (Hemiptera), принадлежа к семейству гладышей (Notonectidae). Часто ...

Основы селекции
Основы селекции Селекцией (лат. selectio отбор) называют комплексную биологическую дисциплину, направленную на выведение сортов растений, пород животных и штаммов микроорганизмов с нужны ...

Мухи
Эти миниатюрные создания проявляют удивительную способность ощущать окружающий мир, целенаправленно действовать соответственно обстановке, быстро двигаться, ловко манипулировать своими коне ...